PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01399.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 455aa    MW: 49470.3 Da    PI: 8.5457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01399.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.36.5e-121446134
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34
                                  rg WT+eEd +l+ +++q+G+++W++I++  g  
  Zmw_sc01399.1.g00280.1.am.mk 14 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAG-L 46
                                  89***************************999.3 PP

2Myb_DNA-binding44.73e-1490132246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc01399.1.g00280.1.am.mk  90 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 132
                                   789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.649983IPR017930Myb domain
SuperFamilySSF466895.99E-2513130IPR009057Homeodomain-like
SMARTSM007172.9E-111385IPR001005SANT/Myb domain
PfamPF002499.2E-131483IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231590IPR009057Homeodomain-like
CDDcd001671.12E-91783No hitNo description
PROSITE profilePS5129424.90584138IPR017930Myb domain
SMARTSM007172.8E-1488136IPR001005SANT/Myb domain
PfamPF002499.0E-1390132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2491138IPR009057Homeodomain-like
CDDcd001672.11E-1091134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MGRVPCCEKD IVKRGQWTPE EDNKLLSYIT QYGTRNWRLI PKNAGLSPAN ACARQRPPSH  60
KFLPALRLQR CGKSCRLRWT NYLRPDLKHG EFTDAEEQTI IKLHSVVGNR WSVIAAQLPG  120
RTDNDVKNHW NTKLKKKLSG MGIDPVTHKS FSHLMAEIAT TLAPPQVAHL AEAALGCFKD  180
EMLHLLTKKR PTVPDMAPAP GAGIGMGIAG GTAAPSFPAQ PQADDTIERI KLGLSRAIMN  240
EPGASASDKH QPPWAPVDVP EGLTGMYAPY DPSQVHENFR YEGTVSEYVL GGGDADQGTS  300
MWSHQSIYSG SSGTEAPRAA SALPKKGNDS VGSSRGEDEM DDSKEGGKGG SDMSGLFGSD  360
CVLWDLPDVL TNHMVMPRLT RCIGRSERAR LEFTLLLLSE IFTEKCSVSP FLFSMAAAQL  420
HGSAAAAASY RRTRPFAVSP SCRWVQNPLP GSPKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28101384108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146260.10.0putative MYB DNA-binding domain superfamily protein
SwissprotQ7XQN11e-170MYB80_ORYSJ; Transcription factor MYB80
TrEMBLB4FAV00.0B4FAV0_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G173633_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339